PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_67.g401.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family SBP
Protein Properties Length: 378aa    MW: 41909.4 Da    PI: 9.6005
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_67.g401.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP106.12.5e-3380156278
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          Cqv+gC   + ++key++r+k+C  h +a+  lv+g++ rfCqqC+rf  lsefD +krsCr+rLa+hn+rrrk
  model.Picochlorum_contig_67.g401.t1  80 CQVPGCVRPIDNMKEYYKRYKICPYHMEANFLLVEGQSIRFCQQCGRFQLLSEFDGDKRSCRKRLARHNSRRRK 153
                                          ************************************************************************** PP

                                          --- CS
                                  SBP  76 kqa 78 
                                          ++a
  model.Picochlorum_contig_67.g401.t1 154 SEA 156
                                          976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114126.30777154IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.6E-2877141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3079156IPR004333Transcription factor, SBP-box
PfamPF031103.3E-3080153IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MSSDSSSSSE SDDSRTQSSD SNGIREVNGN QPTHITFPEV PGFSNALDAY VCQNTAPGPR  60
YRRGRGRSFF KDSPVGKNSC QVPGCVRPID NMKEYYKRYK ICPYHMEANF LLVEGQSIRF  120
CQQCGRFQLL SEFDGDKRSC RKRLARHNSR RRKSEAEGGR IVQQDQVPSR SNHEQGTPVP  180
SRKTAYELIN SALQNVLEAM RVDGLHETPD AAVVKVRSLV ALMELQQALQ ELSRNRSRLK  240
SQESPSRHSL PPEILQHAMS RLLQQRQVPV LQTSAMGPQM QQLNMPGAIT SPPIDPLAMG  300
SQINPQLAMM QNFSPMNPTQ VMPPQQAAMP QGLTPHIPSH GGDSRQDVLP QNGAQSSEPT  360
PDKLSILLET LKQASKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-2180161687squamosa promoter binding protein-like 7
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148153SRRRKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-24squamosa promoter binding protein-like 8